General Information

  • ID:  hor006103
  • Uniprot ID:  P01302
  • Protein name:  C-terminal peptide 2
  • Gene name:  PPY
  • Organism:  Bos taurus (Bovine)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DKEGTLDFLECGSPHSAVPRWVFSLSCVPRCLGQENGGV
  • Length:  39
  • Propeptide:  MAAAHRCLFLLLLSTCVALLLQPPLGALGAPLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYGKRDKEGTLDFLECGSPHSAVPRYGKRDKEGTLDFLECGSPHSAVPRWVFSLSCVPRCLGQENGGV
  • Signal peptide:  MAAAHRCLFLLLLSTCVALLLQPPLGALG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01302-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006103_AF2.pdbhor006103_ESM.pdb

Physical Information

Mass: 486970 Formula: C182H281N51O57S3
Absent amino acids: IMY Common amino acids: G
pI: 4.66 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 12
Hydrophobicity: -13.59 Boman Index: -5179
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 72.31
Instability Index: 6012.31 Extinction Coefficient cystines: 5625
Absorbance 280nm: 148.03

Literature

  • PubMed ID:  7831336
  • Title:  Seminalplasmin: recent evolution of another member of the neuropeptide Y gene family.
  • PubMed ID:  1734969
  • Title:  Sequence-specific 1H NMR assignments and solution structure of bovine pancreatic polypeptide.